CoraLite® Plus 647-conjugated MCCL19/MIP-3 beta Polyclonal antibody

MCCL19/MIP-3 beta Polyclonal Antibody for FC (Intra)
Cat No. CL647-13397

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

CCL19, CCL19/MIP-3 beta, MIP-3 Beta, MIP-3-beta, Beta chemokine exodus 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-13397 targets MCCL19/MIP-3 beta in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4200

Product name: Recombinant human MIP­3β protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-98 aa of BC027968

Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Predict reactive species
Full Name chemokine (C-C motif) ligand 19
Calculated Molecular Weight 98 aa, 12 kDa
GenBank Accession NumberBC027968
Gene Symbol CCL19/MIP-3 beta
Gene ID (NCBI) 6363
RRIDAB_2934885
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99731
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 MCCL19/MIP-3 beta antibody CL647-13397Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...