Anti-Human CCL22/MDC Rabbit Recombinant Antibody

• 

  FC experiment of human monocyte-derived mature dendritic cells using 98280-1-RR

  1x10^6 human monocyte-derived mature dendritic cells were intracellularly stained with 0.25 ug Anti-Human CCL22 Rabbit RecAb (98280-1-RR, Clone: 241668D5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CCL22/MDC Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98280-1-RR

Clone No.241668D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CCL22, MDC, 241668D5, C C motif chemokine 22, CC chemokine STCP-1

---

Tested Applications

• Positive FC (Intra) detected in: human monocyte-derived mature dendritic cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98280-1-RR targets CCL22/MDC in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1974

  Product name: Recombinant Human CCL22 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 25-93 aa of BC027952

  Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

• Full Name: chemokine (C-C motif) ligand 22
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC027952
• Gene Symbol: CCL22/MDC
• Gene ID (NCBI): 6367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00626
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

The C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors.