FcZero-rAb® Biotin Anti-Human CCL22/MDC Rabbit Recombinant Antibody

• 

  FC experiment of human monocyte-derived mature dendritic cells using Biotin-FcA98280

  1x10^6 human monocyte-derived mature dendritic cells were intracellularly stained with 0.25 ug Biotin Anti-Human CCL22/MDC Rabbit RecAb (Biotin-FcA98280, Clone: 241668D5) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CCL22/MDC FcZero-rAb^® Recombinant Antibody for FC (Intra), ELISA

Cat No. Biotin-FcA98280

Clone No.241668D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

Synonyms

CCL22, MDC, C C motif chemokine 22, CC chemokine STCP-1, C-C motif chemokine 22

---

Tested Applications

• Positive FC (Intra) detected in: human monocyte-derived mature dendritic cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98280 targets CCL22/MDC in FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1974

  Product name: Recombinant Human CCL22 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 25-93 aa of BC027952

  Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

• Full Name: chemokine (C-C motif) ligand 22
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC027952
• Gene Symbol: CCL22/MDC
• Gene ID (NCBI): 6367
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00626
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CCL22, also known as macrophage-derived chemokine (MDC), is a member of the CC chemokine family. It is primarily produced by myeloid cells such as macrophages and dendritic cells (DCs) under steady-state conditions. CCL22 plays a significant role in immune responses by regulating the migration of different subsets of leukocytes. It shares the same receptor, CCR4, which is predominantly expressed by Th2 cells, making CCL22 a key mediator in the development of Th2-dominant diseases such as atopic dermatitis and asthma. Elevated serum levels of CCL22 are observed in patients with these conditions. CCL22 is also expressed in several types of tumor cells and Foxp3+ regulatory T cells (Tregs), suggesting its involvement in attracting Tregs into the tumor microenvironment to evade immune attacks.