• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® Biotin Anti-Human CCL22/MDC Rabbit Recombinant Antibody

CCL22/MDC FcZero-rAb® Recombinant Antibody for FC (Intra), ELISA
Cat No. Biotin-FcA98280
Clone No.241668D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra), ELISA

CCL22, MDC, C C motif chemokine 22, CC chemokine STCP-1, C-C motif chemokine 22

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman monocyte-derived mature dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98280 targets CCL22/MDC in FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1974

Product name: Recombinant Human CCL22 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 25-93 aa of BC027952

Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Predict reactive species
Full Name chemokine (C-C motif) ligand 22
Calculated Molecular Weight 93 aa, 11 kDa
GenBank Accession NumberBC027952
Gene Symbol CCL22/MDC
Gene ID (NCBI) 6367
Conjugate Biotin
Excitation/Emission Maxima Wavelengths-
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00626
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CCL22, also known as macrophage-derived chemokine (MDC), is a member of the CC chemokine family. It is primarily produced by myeloid cells such as macrophages and dendritic cells (DCs) under steady-state conditions. CCL22 plays a significant role in immune responses by regulating the migration of different subsets of leukocytes. It shares the same receptor, CCR4, which is predominantly expressed by Th2 cells, making CCL22 a key mediator in the development of Th2-dominant diseases such as atopic dermatitis and asthma. Elevated serum levels of CCL22 are observed in patients with these conditions. CCL22 is also expressed in several types of tumor cells and Foxp3+ regulatory T cells (Tregs), suggesting its involvement in attracting Tregs into the tumor microenvironment to evade immune attacks.

Protocols

Product Specific Protocols
FC protocol for Biotin CCL22/MDC antibody Biotin-FcA98280Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...