FcZero-rAb® APC Anti-Human CCL22/MDC Rabbit Recombinant Antibody

• 

  FC experiment of human monocyte-derived mature dendritic cells using APC-FcA98280

  1x10^6 human monocyte-derived mature dendritic cells were intracellularly stained with 5 ul APC Anti-Human CCL22/MDC Rabbit RecAb (APC-FcA98280, Clone: 241668D5) (red) or APC Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CCL22/MDC FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. APC-FcA98280

Clone No.241668D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CCL22, MDC, C C motif chemokine 22, CC chemokine STCP-1, C-C motif chemokine 22

---

Tested Applications

• Positive FC (Intra) detected in: human monocyte-derived mature dendritic cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98280 targets CCL22/MDC in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1974

  Product name: Recombinant Human CCL22 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 25-93 aa of BC027952

  Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

• Full Name: chemokine (C-C motif) ligand 22
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC027952
• Gene Symbol: CCL22/MDC
• Gene ID (NCBI): 6367
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00626
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors.