• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CD151 Monoclonal antibody

CD151 Monoclonal Antibody for IF-P
Cat No. CL488-66567
Clone No.2A8G8

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF-P

CD151, CD151 antigen, GP27, Membrane glycoprotein SFA 1, MER2, PETA 3, RAPH, SFA1, Tetraspanin 24, Tspan 24, TSPAN24

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66567 targets CD151 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25985

Product name: Recombinant human CD151 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 113-221 aa of BC001374

Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR

Predict reactive species
Full Name CD151 molecule (Raph blood group)
Calculated Molecular Weight 28 kDa
GenBank Accession NumberBC001374
Gene Symbol CD151
Gene ID (NCBI) 977
RRIDAB_2883357
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP48509
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells. And the antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD151 antibody CL488-66567Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...