Tested Applications
Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-66567 targets CD151 in IF-P applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25985 Product name: Recombinant human CD151 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 113-221 aa of BC001374 Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Predict reactive species |
Full Name | CD151 molecule (Raph blood group) |
Calculated Molecular Weight | 28 kDa |
GenBank Accession Number | BC001374 |
Gene Symbol | CD151 |
Gene ID (NCBI) | 977 |
RRID | AB_2883357 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P48509 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells. And the antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 CD151 antibody CL488-66567 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |