Anti-Human CD28 Rabbit Recombinant Antibody

CD28 Uni-rAb® Recombinant Antibody for FC

Cat No. 98032-1-RR
Clone No.240354D2

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

240354D2, CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98032-1-RR targets CD28 in FC applications and shows reactivity with human, monkey, non-human primates samples.

Tested Reactivity human, monkey, non-human primates
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0889

Product name: Recombinant Human CD28 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-152 aa of BC093698

Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Predict reactive species
Full Name CD28 molecule
Calculated Molecular Weight 220 aa, 25 kDa
GenBank Accession NumberBC093698
Gene Symbol CD28
Gene ID (NCBI) 940
ENSEMBL Gene IDENSG00000178562
RRIDAB_3672177
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10747
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Stable for one year after shipment.

Background Information

CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520).

Protocols

Product Specific Protocols
FC protocol for CD28 antibody 98032-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...