Anti-Human CD28 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98032-1-RR (same clone as 98032-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD28 Rabbit Recombinant Antibody (98032-1-RR, Clone: 240354D2) or Isotype Control, and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cell were then stained with CoraLite® Plus 647 Anti-Human CD3. Cells were not fixed. Lymphocytes were gated. This data was developed using the same antibody clone with 98032-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98032-1-RR (same clone as 98032-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD28 Rabbit Recombinant Antibody (98032-1-RR, Clone: 240354D2) (red) or Isotype Control (blue), and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were not fixed. Lymphocytes were gated. This data was developed using the same antibody clone with 98032-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98032-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98032-1-RR against Human CD28 were performed. The affinity constant is 3.23 nM.

CD28 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98032-1-PBS

Clone No.240354D2

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

Synonyms

240354D2, CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

---

Product Information

98032-1-PBS targets CD28 in FC applications and shows reactivity with human, monkey, non-human primates samples.

• Tested Reactivity: human, monkey, non-human primates
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0889

  Product name: Recombinant Human CD28 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-152 aa of BC093698

  Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

• Full Name: CD28 molecule
• Calculated Molecular Weight: 220 aa, 25 kDa
• GenBank Accession Number: BC093698
• Gene Symbol: CD28
• Gene ID (NCBI): 940
• ENSEMBL Gene ID: ENSG00000178562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10747
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520).