CoraLite® Plus 488 Anti-Human CD28 Rabbit Recombinant Antibody

CD28 Uni-rAb® Recombinant Antibody for FC
Cat No. CL488-98032
Clone No.240354D2

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey, non-human primates

Applications

FC

240354D2, CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 μl per 10^6 cells in a 100 µl suspension or 5 μl per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98032 targets CD28 in FC applications and shows reactivity with human, monkey, non-human primates samples.

Tested Reactivity human, monkey, non-human primates
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0889

Product name: Recombinant Human CD28 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-152 aa of BC093698

Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Predict reactive species
Full Name CD28 molecule
Calculated Molecular Weight 220 aa, 25 kDa
GenBank Accession NumberBC093698
Gene Symbol CD28
Gene ID (NCBI) 940
ENSEMBL Gene IDENSG00000178562
RRIDAB_3673377
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10747
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CD28 antibody CL488-98032Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...