Tested Applications
| Positive FC detected in | human PBMCs |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-98235 targets CD300e in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2638 Product name: recombinant human CD300E protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 19-131 aa of NM_181449.2 Sequence: KGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAI Predict reactive species |
| Full Name | CD300e molecule |
| Calculated Molecular Weight | 23 kDa |
| GenBank Accession Number | NM_181449.2 |
| Gene Symbol | CD300E |
| Gene ID (NCBI) | 342510 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q496F6 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CD300e, also known as immune receptor expressed on myeloid cells 2 (IREM-2), CLM-2, or CMRF35-A5, is one of the CD300 family members which belong to the immunoglobulin (Ig) superfamily (PMID: 15557162; 20039296). CD300e is a type I transmembrane glycoprotein that contains an extracellular region comprising an Ig-like domain, a transmembrane region, and a short cytoplasmic tail (PMID: 15557162; 29358324). It is by monocytes and myeloid dendritic cells and transmits an immune-activating signal by interacting with DNAX-activating protein 12 (DAP12) (PMID: 29358324).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 CD300e antibody CL594-98235 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



