CoraLite® Plus 488-conjugated CD37 Recombinant monoclonal antibody

CD37 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-85917
Clone No.250262A3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IF-P

Leukocyte antigen CD37, Tetraspanin 26, TSPAN26

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse spleen tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85917 targets CD37 in IF-P applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2729

Product name: Recombinant Mouse CD37 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 112-241 aa of NM_007645.4

Sequence: RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN

Predict reactive species
Full Name CD37 antigen
Calculated Molecular Weight32 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberNM_007645.4
Gene Symbol Cd37
Gene ID (NCBI) 12493
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ61470
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD37 antibody CL488-85917Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...