Mouse CD90 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85677-1-RR (same clone as 85677-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85677-1-RR (CD90 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85677-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 85677-1-RR (same clone as 85677-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85677-1-RR (CD90/Thy1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85677-1-PBS in a different storage buffer formulation.

CD90 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85677-1-PBS

Clone No.242910H7

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Thy1, Thy 1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein

---

Product Information

85677-1-PBS targets CD90 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1380

  Product name: Recombinant Mouse CD90/Thy1 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-131 aa of NM_009382.3

  Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC

• Full Name: thymus cell antigen 1, theta
• Calculated Molecular Weight: 18kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_009382.3
• Gene Symbol: CD90
• Gene ID (NCBI): 21838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01831
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T-cell activation (PMID: 7683034).