Tested Applications
| Positive IF/ICC detected in | Caco-2 cells, HepG2 cells |
| Positive FC (Intra) detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-82659 targets CDX2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17310 Product name: Recombinant human CDX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC014461 Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ Predict reactive species |
| Full Name | caudal type homeobox 2 |
| Calculated Molecular Weight | 313 aa, 34 kDa |
| Observed Molecular Weight | 33-40 kDa |
| GenBank Accession Number | BC014461 |
| Gene Symbol | CDX2 |
| Gene ID (NCBI) | 1045 |
| RRID | AB_3673070 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99626 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 CDX2 antibody CL488-82659 | Download protocol |
| IF protocol for CL Plus 488 CDX2 antibody CL488-82659 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







