CDX2 Recombinant monoclonal antibody

CDX2 Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 82659-1-RR
Clone No.3J1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CDX-2, CDX 3, Caudal-type homeobox protein 2, Caudal type homeobox protein 2, Caudal type homeobox 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, mouse colon tissue, COLO 320 cells
Positive IHC detected inrat colon tissue, human colon cancer tissue, human rectal cancer tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

82659-1-RR targets CDX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17310

Product name: Recombinant human CDX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC014461

Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ

Predict reactive species
Full Name caudal type homeobox 2
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight 33-40 kDa
GenBank Accession NumberBC014461
Gene Symbol CDX2
Gene ID (NCBI) 1045
RRIDAB_3086497
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99626
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.

Protocols

Product Specific Protocols
IF protocol for CDX2 antibody 82659-1-RRDownload protocol
IHC protocol for CDX2 antibody 82659-1-RRDownload protocol
WB protocol for CDX2 antibody 82659-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Biofabrication

3D bioprinting platform development for high-throughput cancer organoid models construction and drug evaluation

Authors - Rui Dai
Loading...
||
New chat Able
正在加载,请稍候...