CoraLite® Plus 488-conjugated CHST4 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66623

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 CHST4 antibody (CL488-66623, Clone: 1E1A4 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

CHST4 Monoclonal Antibody for IF/ICC

Cat No. CL488-66623

Clone No.1E1A4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

Synonyms

CHST4, GlcNAc6ST 2, Gn6st 2, GST 3, HEC GlcNAc6ST, LSST

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66623 targets CHST4 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3987

  Product name: Recombinant human CHST4 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 177-386 aa of BC035282

  Sequence: DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH

• Full Name: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
• Calculated Molecular Weight: 370 aa, 43 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC035282
• Gene Symbol: CHST4
• Gene ID (NCBI): 10164
• RRID: AB_2919351
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NCG5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CHST4, also named as HEC GlcNAc6ST and GlcNAc6ST 2, is one of a major GlcNAc-6-O-sulfotransferases involved in synthesizing the L-selectin ligands mediating lymphocyte homing. CHST4 is associated with the expression of MECA-79 epitope on HEV. It has been reported that the transcripts of CHST4 can be detected in lymph node, liver, pancreas and high endothelial venules (HEVs) but at a low level in HUVECs. Besides, CHST4 is expressed at a high level in gastric and colorectal cancer patients compared with normal mucosa. (PMID:30093410, 27748735, 10330415)