CLDN16 Recombinant monoclonal antibody

• 

  IHC staining of mouse kidney using 82954-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 82954-1-RR (CLDN16 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 82954-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 82954-1-RR (CLDN16 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 82954-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CLDN16 antibody (82954-1-RR, Clone: 230193G3 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CLDN16 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 82954-1-RR

Clone No.230193G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

230193G3, Claudin-16, Paracellin-1, PCLN1, PCLN-1

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82954-1-RR targets CLDN16 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26531

  Product name: Recombinant human CLDN16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC069682

  Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD

• Full Name: claudin 16
• Calculated Molecular Weight: 305 aa, 34 kDa
• GenBank Accession Number: BC069682
• Gene Symbol: CLDN16
• Gene ID (NCBI): 10686
• RRID: AB_3670698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5I7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.