CoraLite® Plus 488-conjugated CLDN16 Recombinant monoclonal antibody

• 

  IF Staining of HEK-293 using CL488-82954

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CoraLite® Plus 488 CLDN16 antibody (CL488-82954, Clone: 230193G3 ) at dilution of 1:200.

CLDN16 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82954

Clone No.230193G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

230193G3, Claudin-16, Paracellin-1, PCLN1, PCLN-1

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82954 targets CLDN16 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26531

  Product name: Recombinant human CLDN16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-73 aa of BC069682

  Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD

• Full Name: claudin 16
• Calculated Molecular Weight: 305 aa, 34 kDa
• GenBank Accession Number: BC069682
• Gene Symbol: CLDN16
• Gene ID (NCBI): 10686
• RRID: AB_3673150
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y5I7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.