CoraLite® Plus 488-conjugated CLDN16 Recombinant monoclonal antibody

CLDN16 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82954
Clone No.230193G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

230193G3, Claudin-16, Paracellin-1, PCLN1, PCLN-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82954 targets CLDN16 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag26531

Product name: Recombinant human CLDN16 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-73 aa of BC069682

Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD

Predict reactive species
Full Name claudin 16
Calculated Molecular Weight 305 aa, 34 kDa
GenBank Accession NumberBC069682
Gene Symbol CLDN16
Gene ID (NCBI) 10686
RRIDAB_3673150
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y5I7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. They have similar structures with four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-16 is primarily found in the kidneys and is responsible for regulating the reabsorption of magnesium and calcium ions. Mutations in the Claudin-16 gene can lead to a rare genetic disorder called familial hypomagnesemia with hypercalciuria and nephrocalcinosis (FHHNC).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CLDN16 antibody CL488-82954Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...