Tested Applications
| Positive WB detected in | SK-N-SH cells, human rectum tissue, rabbit large intestine tissue, human placenta tissue, pig skin tissue, rat skin tissue, mouse skin tissue. rat colon tissue, rabbit colon tissue |
| Positive IHC detected in | human ovary tumor tissue, human hepatocirrhosis tissue, human placenta tissue, mouse skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 17 publications below |
| IHC | See 13 publications below |
| IF | See 6 publications below |
Product Information
68320-1-Ig targets Collagen Type III in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat, pig, rabbit |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4229 Product name: Recombinant human COL3A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1150-1466 aa of BC028178 Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL Predict reactive species |
| Full Name | collagen, type III, alpha 1 |
| Calculated Molecular Weight | 1466 aa, 139 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC028178 |
| Gene Symbol | COL3A1 |
| Gene ID (NCBI) | 1281 |
| RRID | AB_2935393 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P02461 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Collagen Type III antibody 68320-1-Ig | Download protocol |
| IHC protocol for Collagen Type III antibody 68320-1-Ig | Download protocol |
| WB protocol for Collagen Type III antibody 68320-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Biol Toxicol NAT10 Mediates Cardiac Fibrosis Induced by Myocardial Infarction Through ac4C Modification of TGFBR1 mRNA | ||
Int J Mol Sci A Positive Feedback Loop Exists between Estradiol and IL-6 and Contributes to Dermal Fibrosis | ||
Bioact Mater Magnesium ions attenuate tendon graft fibrosis during its ligamentization after ACL reconstruction through modulation of fibroblast to myofibroblast trans-differentiation by promoting PGE2 secretion | ||
Int Immunopharmacol Deficiency of Med1 in keratinocytes augments dermal fibrosis and inflammation in scleroderma. | ||
J Nanobiotechnology NIR-II light based combinatorial management of hypertrophic scar by inducing autophagy in fibroblasts | ||
Mutat Res The active compound quercetin from Polygonum cuspidatum targets COL3A1 to enhance CD8⁺ T cell cytotoxicity in gastric cancer. |
