Filter: AllWBIHCIF-P

WB analysis using 68320-1-Ig (same clone as 68320-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
WB analysis of human placenta using 68320-1-Ig (same clone as 68320-1-PBS)
human placenta tissue were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
WB analysis of human rectum using 68320-1-Ig (same clone as 68320-1-PBS)
human rectum tissue were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
WB analysis of rabbit large intestine using 68320-1-Ig (same clone as 68320-1-PBS)
rabbit large intestine tissue were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 68320-1-Ig (same clone as 68320-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
IHC staining of mouse skin using 68320-1-Ig (same clone as 68320-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 68320-1-Ig (same clone as 68320-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 68320-1-Ig (same clone as 68320-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 68320-1-Ig (same clone as 68320-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
IF Staining of human colon cancer using 68320-1-Ig (same clone as 68320-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human colon cancer tissue using Collagen Type III antibody (68320-1-Ig, Clone: 3B1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human colon cancer tissue using Collagen Type III antibody (68320-1-Ig, Clone: 3B1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68320-1-PBS in a different storage buffer formulation.

Collagen Type III Monoclonal antibody, PBS Only

Collagen Type III Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 68320-1-PBS

Clone No.3B1F3

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

COL3, COL3A1, 3B1F3, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

68320-1-PBS targets Collagen Type III in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag4229 Product name: Recombinant human COL3A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1150-1466 aa of BC028178 Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL Predict reactive species
Full Name	collagen, type III, alpha 1
Calculated Molecular Weight	1466 aa, 139 kDa
Observed Molecular Weight	130 kDa
GenBank Accession Number	BC028178
Gene Symbol	COL3A1
Gene ID (NCBI)	1281
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P02461
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).