Collagen Type III Monoclonal antibody, PBS Only

Collagen Type III Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 68320-1-PBS
Clone No.3B1F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Indirect ELISA

COL3, COL3A1, 3B1F3, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68320-1-PBS targets Collagen Type III in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4229

Product name: Recombinant human COL3A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1150-1466 aa of BC028178

Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL

Predict reactive species
Full Name collagen, type III, alpha 1
Calculated Molecular Weight 1466 aa, 139 kDa
Observed Molecular Weight130 kDa
GenBank Accession NumberBC028178
Gene Symbol COL3A1
Gene ID (NCBI) 1281
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02461
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).

Loading...
||
New chat Able
正在加载,请稍候...