Tested Applications
Positive WB detected in | HL-60 cells, Caco-2 cells, HeLa cells, HepG2 cells |
Positive IHC detected in | human liver cancer tissue, human gliomas tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 8 publications below |
Product Information
11425-1-AP targets COX6B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1984 Product name: Recombinant human COX6B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC001015 Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Predict reactive species |
Full Name | cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) |
Calculated Molecular Weight | 80 aa, 10 kDa |
Observed Molecular Weight | 10-13 kDa |
GenBank Accession Number | BC001015 |
Gene Symbol | COX6B1 |
Gene ID (NCBI) | 1340 |
RRID | AB_2085449 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P14854 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX6B1 (Cytochrome c oxidase subunit 6B1) is also named as COX6B and belongs to the cytochrome c oxidase subunit 6B family. It connects the two COX monomers into the physiological dimeric form. Defects in COX6B1 are a cause of mitochondrial complex IV deficiency (MT-C4D).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COX6B1 antibody 11425-1-AP | Download protocol |
IHC protocol for COX6B1 antibody 11425-1-AP | Download protocol |
IF protocol for COX6B1 antibody 11425-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Biol PDGFRβ translocates to the nucleus and regulates chromatin remodeling via TATA element-modifying factor 1. | ||
Hum Reprod Posttranslational lysine 2-hydroxyisobutyrylation of human sperm tail proteins affects motility. | ||
J Biol Chem The cellular stress proteins CHCHD10 and MNRR1 (CHCHD2): Partners in mitochondrial and nuclear function and dysfunction. | ||
Mol Med Rep Overexpression of COX6B1 protects against I/R‑induced neuronal injury in rat hippocampal neurons. |