Tested Applications
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-11425 targets COX6B1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1984 Product name: Recombinant human COX6B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC001015 Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Predict reactive species |
| Full Name | cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) |
| Calculated Molecular Weight | 80 aa, 10 kDa |
| Observed Molecular Weight | 10-13 kDa |
| GenBank Accession Number | BC001015 |
| Gene Symbol | COX6B1 |
| Gene ID (NCBI) | 1340 |
| RRID | AB_3672496 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14854 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
COX6B1 (Cytochrome c oxidase subunit 6B1) is also named as COX6B and belongs to the cytochrome c oxidase subunit 6B family. It connects the two COX monomers into the physiological dimeric form. Defects in COX6B1 are a cause of mitochondrial complex IV deficiency (MT-C4D).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 COX6B1 antibody CL488-11425 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

