• Featured Product
  • KD/KO Validated

CPT1A Polyclonal antibody

The CPT1A polyclonal antibody (15184-1-AP) is the highest cited CPT1A antibody in the market with 461 citations.

Cat No. 15184-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA

Carnitine O-palmitoyltransferase 1, liver isoform, Carnitine O-palmitoyltransferase I, liver isoform, CPT I, CPT1, CPT-1A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, A549 cells, MCF-7 cells, mouse liver tissue, mouse spleen tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15184-1-AP targets CPT1A in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, zebrafish, bovine, goat, yellow croaker, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7202

Product name: Recombinant human CPT1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 406-756 aa of BC000185

Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT

Predict reactive species
Full Name carnitine palmitoyltransferase 1A (liver)
Calculated Molecular Weight 88 kDa
Observed Molecular Weight 86 kDa
GenBank Accession NumberBC000185
Gene Symbol CPT1A
Gene ID (NCBI) 1374
RRIDAB_2084676
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50416
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CPT1A, also named CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. CPT1A gene is localized Chromosome 11q13.1-2. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active form of related liver-type carnitine palmitoyltransferase I (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes.

Protocols

Product Specific Protocols
FC protocol for CPT1A antibody 15184-1-APDownload protocol
IF protocol for CPT1A antibody 15184-1-APDownload protocol
IHC protocol for CPT1A antibody 15184-1-APDownload protocol
IP protocol for CPT1A antibody 15184-1-APDownload protocol
WB protocol for CPT1A antibody 15184-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Res

Hypoxia induces mitochondrial protein lactylation to limit oxidative phosphorylation

Authors - Yunzi Mao
mouseWB

Nature

High-fat diet enhances stemness and tumorigenicity of intestinal progenitors.

Authors - Semir Beyaz
mouseWB,IF

Cell Metab

Quiescent Endothelial Cells Upregulate Fatty Acid β-Oxidation for Vasculoprotection via Redox Homeostasis.

Authors - Joanna Kalucka
mouseWB

Cell

Mitochondrial Priming by CD28.

Authors - Ramon I Klein Geltink
  • KD Validated
mouseWB

Cell Metab

Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity

Authors - Zilong Zhang
mouseIHC

Cell Metab

SGLT2 Inhibition Mediates Protection from Diabetic Kidney Disease by Promoting Ketone Body-Induced mTORC1 Inhibition.

Authors - Issei Tomita

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

YINGJIAN (Verified Customer) (08-07-2025)

It yields a clear signal with minimal background in both Western blot and immunohistochemistry assays

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: liver
CPT1A Antibody Western Blot,Immunohistochemistry validation (1:5000 dilution) in liver (Cat no:15184-1-AP)
FH

Yuan (Verified Customer) (09-12-2024)

We suffered from poor images with CPT1 antibodies purchased from other companies. This antibody saved us. The top band is CPT1A at 80 kDa and the bottom one is GAPDH in the attached graph.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500 in 1% BSA/TBST
  • Cell Tissue Type: Human primary dermal fibroblast
CPT1A Antibody Western Blot validation (1:500 in 1% BSA/TBST dilution) in Human primary dermal fibroblast (Cat no:15184-1-AP)
FH

Tom (Verified Customer) (05-17-2021)

Antibody used at 1/1000 for 24 hours at 4 degrees. Non-specific bands were also present upon imaging.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HEK293
CPT1A Antibody Western Blot validation (1/1000 dilution) in HEK293 (Cat no:15184-1-AP)
FH

Linlin (Verified Customer) (05-08-2019)

This CPT1A antibody is ideal for precipitation of CPT1A in cell lysates and immunoblot analysis of CPT1A. Recommend.

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: 2ug per pulldown; 1000x for immunoblot analysis
  • Cell Tissue Type: mice lung macrophages cell line
CPT1A Antibody Western Blot,Immunoprecipitation, validation (2ug per pulldown; 1000x for immunoblot analysis dilution) in mice lung macrophages cell line (Cat no:15184-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...