CRMP1 Polyclonal antibody

• 

  WB analysis using 10317-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10317-1-AP (CRMP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10317-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10317-1-AP (CRMP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 10317-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10317-1-AP (CRMP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 10317-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10317-1-AP (CRMP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 10317-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10317-1-AP (CRMP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10317-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10317-1-AP (CRMP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 10317-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CRMP1 antibody (10317-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of U2OS using 10317-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CRMP1 antibody (10317-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

CRMP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10317-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

DRP1, DRP 1, DPYSL1, Dihydropyrimidinase-related protein 1, CRMP-1

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse brain tissue, rat lung tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• CoIP: See 1 publications below

Product Information

10317-1-AP targets CRMP1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0369

  Product name: Recombinant human CRMP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-537 aa of BC000252

  Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS

• Full Name: collapsin response mediator protein 1
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC000252
• Gene Symbol: CRMP1
• Gene ID (NCBI): 1400
• RRID: AB_2085347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14194
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62-kDa protein and its 75-kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Chem Biol Interact; Exposure to Benzo(a)pyrene damages mitochondrial function via suppressing mitochondrial melatonin receptors in ovarian corpus luteum during early pregnancy; Authors - Jie Yang
		Mol Med Rep; Angelicin inhibits liver cancer growth in vitro and in vivo.; Authors - Fengliang Wang
rat	WB	Molecules; Senescent Phenotype of Astrocytes Leads to Activation of BV2 Microglia and N2a Neuronal Cells Death; Authors - Wenyou Zhang
mouse,human	WB,CoIP	Neuron; Species-specific FMRP regulation of RACK1 is critical for prenatal cortical development; Authors - Minjie Shen