CRMP1 Monoclonal antibody

CRMP1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68021-1-Ig
Clone No.2F4G5

Host / Isotype

Mouse / IgG2a

Reactivity

Mouse, Rat, Rabbit, Pig, Chicken, Human and More (2)

Applications

WB, IHC, ELISA

CRMP 1, CRMP1, DPYSL1, DRP 1, DRP1, ULIP 3, ULIP3, Unc 33 like phosphoprotein 3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse cerebellum tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue
Positive IHC detected inmouse brain tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

68021-1-Ig targets CRMP1 in WB, IHC, ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples.

Tested Reactivity Mouse, Rat, Rabbit, Pig, Chicken, Human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30090

Product name: Recombinant human CRMP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 291-537 aa of BC000252

Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS

Predict reactive species
Full Name collapsin response mediator protein 1
Calculated Molecular Weight 62 kDa
Observed Molecular Weight62 kDa
GenBank Accession NumberBC000252
Gene Symbol CRMP1
Gene ID (NCBI) 1400
RRIDAB_2918766
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14194
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62 kDa protein and its 74 kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.

Protocols

Product Specific Protocols
WB protocol for CRMP1 antibody 68021-1-IgDownload protocol
IHC protocol for CRMP1 antibody 68021-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Food Chem Toxicol

Inhibiting fatty acid-binding protein 4 reverses inflammation and apoptosis in wasp sting-induced acute kidney injury

Authors - Ling Li
Loading...