CRYBB2 Polyclonal antibody

• 

  WB analysis using 18154-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18154-1-AP (CRYBB2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 18154-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18154-1-AP (CRYBB2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of fetal human brain using 18154-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 18154-1-AP (CRYBB2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 18154-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18154-1-AP (CRYBB2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

CRYBB2 Polyclonal Antibody for WB, ELISA

Cat No. 18154-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, ELISA

Synonyms

Beta B2 crystallin, Beta crystallin B2, Beta crystallin Bp, CCA2, CRYB2, CRYB2A, CRYBB2, crystallin, beta B2, D22S665

---

Tested Applications

• Positive WB detected in: mouse eye tissue, mouse brain tissue, fetal human brain tissue, rat eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

18154-1-AP targets CRYBB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12906

  Product name: Recombinant human CRYBB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC069535

  Sequence: MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN

• Full Name: crystallin, beta B2
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC069535
• Gene Symbol: CRYBB2
• Gene ID (NCBI): 1415
• RRID: AB_2878510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43320
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cells; Effect of a Lens Protein in Low-Temperature Culture of Novel Immortalized Human Lens Epithelial Cells (iHLEC-NY2).; Authors - Naoki Yamamoto
		Invest Ophthalmol Vis Sci; Relationship Between the Altered Expression and Epigenetics of GSTM3 and Age-Related Cataract.; Authors - Bo Li
zebrafish	WB	FASEB J; Knockout of miR-184 in zebrafish leads to ocular abnormalities by elevating p21 levels; Authors - Jing Zhang