Tested Applications
| Positive FC (Intra) detected in | LPS and Brefeldin A treated mouse splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98047-1-RR targets CXCL1 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0303 Product name: Recombinant mouse Cxcl1 protein (N-6*HIS) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 25-96 aa of NM_008176 Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 1 |
| Calculated Molecular Weight | 10kd |
| GenBank Accession Number | NM_008176 |
| Gene Symbol | Cxcl1 |
| Gene ID (NCBI) | 14825 |
| RRID | AB_3672194 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P12850-1 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Stable for one year after shipment. |
Background Information
CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CXCL1 antibody 98047-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



