CoraLite® Plus 647 Anti-Mouse CXCL1 Rabbit Recombinant Antibody

CXCL1 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL647-98047
Clone No.240268D2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

240268D2, chemokine (C X C motif) ligand 1, Growth-regulated alpha protein

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inLPS and Brefeldin A treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98047 targets CXCL1 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0303

Product name: Recombinant mouse Cxcl1 protein (N-6*HIS)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*HIS

Domain: 25-96 aa of NM_008176

Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 1
Calculated Molecular Weight10kd
GenBank Accession Number NM_008176
Gene Symbol Cxcl1
Gene ID (NCBI) 14825
RRIDAB_3673679
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12850-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CXCL1 antibody CL647-98047Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...