Tested Applications
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83927 targets CXCR7 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 7 |
| Calculated Molecular Weight | 362 aa, 41 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC036661 |
| Gene Symbol | CXCR7 |
| Gene ID (NCBI) | 57007 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P25106 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a G-protein coupled receptor family member. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. The expression of CXCR7 has been associated with cardiac development, tumor growth, and progression.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 CXCR7 antibody CL488-83927 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

