CXCR7 Recombinant monoclonal antibody

• 

  WB analysis using 83927-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83927-1-RR (CXCR7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 83927-1-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CXCR7 antibody (83927-1-RR, Clone: 240842C9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CXCR7 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 83927-1-RR

Clone No.240842C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ACKR3, 240842C9, Atypical chemokine receptor 3, Chemokine orphan receptor 1, CMKOR1

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells, Raji cells, U-87 MG cells
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83927-1-RR targets CXCR7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14247

  Product name: Recombinant human CXCR7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 273-362 aa of BC036661

  Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK

• Full Name: chemokine (C-X-C motif) receptor 7
• Calculated Molecular Weight: 362 aa, 41 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC036661
• Gene Symbol: CXCR7
• Gene ID (NCBI): 57007
• RRID: AB_3671507
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P25106
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a G-protein coupled receptor family member. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. The expression of CXCR7 has been associated with cardiac development, tumor growth, and progression.