Ch-TOG Monoclonal antibody

• 

  WB analysis using 67631-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67631-1-Ig (CKAP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67631-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67631-1-Ig (CKAP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 67631-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 67631-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human rectal cancer using 67631-1-Ig

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human rectal cancer using 67631-1-Ig

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67631-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Ch-TOG antibody (67631-1-Ig, Clone: 1H5G1 ) at dilution of 1:4000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

Ch-TOG Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67631-1-Ig

Clone No.1H5G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CKAP5, TOGp, Cytoskeleton-associated protein 5, Colonic and hepatic tumor overexpressed gene protein, ch TOG

---

Tested Applications

• Positive WB detected in: pig brain tissue, HeLa cells, HepG2 cells, NCCIT cells, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse cerebellum tissue, human rectal cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67631-1-Ig targets Ch-TOG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28770

  Product name: Recombinant human CKAP5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-349 aa of BC120869

  Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV

• Full Name: cytoskeleton associated protein 5
• Observed Molecular Weight: 220-240 kDa
• GenBank Accession Number: BC120869
• Gene Symbol: Ch-TOG
• Gene ID (NCBI): 9793
• RRID: AB_2882832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14008
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles.