Ch-TOG Monoclonal antibody, PBS Only (Capture/Detector)

Ch-TOG Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 67631-1-PBS
Clone No.1H5G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

CKAP5, 1H5G1, ch TOG, Colonic and hepatic tumor overexpressed gene protein, Cytoskeleton-associated protein 5

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67631-1-PBS targets Ch-TOG as part of a matched antibody pair:

MP50224-1: 67631-2-PBS capture and 67631-1-PBS detection (validated in Cytometric bead array)

MP50224-2: 67631-1-PBS capture and 67631-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28770

Product name: Recombinant human CKAP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-349 aa of BC120869

Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV

Predict reactive species
Full Name cytoskeleton associated protein 5
Observed Molecular Weight 220-240 kDa
GenBank Accession NumberBC120869
Gene Symbol Ch-TOG
Gene ID (NCBI) 9793
RRIDAB_2882832
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14008
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles.

Loading...
||
New chat Able
正在加载,请稍候...