Filter: AllWBIHCIF/ICCCytometric bead array

WB analysis using 67631-1-Ig (same clone as 67631-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67631-1-Ig (CKAP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
WB analysis using 67631-1-Ig (same clone as 67631-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67631-1-Ig (CKAP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 67631-1-Ig (same clone as 67631-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 67631-1-Ig (same clone as 67631-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
IHC staining of human rectal cancer using 67631-1-Ig (same clone as 67631-1-PBS)
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
IHC staining of human rectal cancer using 67631-1-Ig (same clone as 67631-1-PBS)
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 67631-1-Ig (Ch-TOG antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 67631-1-Ig (same clone as 67631-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Ch-TOG antibody (67631-1-Ig, Clone: 1H5G1 ) at dilution of 1:4000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67631-1-PBS in a different storage buffer formulation.
Cytometric bead array standard curve of MP50224-1
Cytometric bead array standard curve of MP50224-1, CKAP5 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67631-2-PBS. Detection antibody: 67631-1-PBS. Standard:Ag28770. Range: 0.391-100 ng/mL.
Cytometric bead array standard curve of MP50224-2
Cytometric bead array standard curve of MP50224-2, CKAP5 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67631-1-PBS. Detection antibody: 67631-3-PBS. Standard:Ag28770. Range: 6.25-100 ng/mL.

Ch-TOG Monoclonal antibody, PBS Only (Capture/Detector)

Ch-TOG Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67631-1-PBS

Clone No.1H5G1

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

CKAP5, 1H5G1, ch TOG, Colonic and hepatic tumor overexpressed gene protein, Cytoskeleton-associated protein 5

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67631-1-PBS targets Ch-TOG as part of a matched antibody pair:

MP50224-1: 67631-2-PBS capture and 67631-1-PBS detection (validated in Cytometric bead array)

MP50224-2: 67631-1-PBS capture and 67631-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28770 Product name: Recombinant human CKAP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-349 aa of BC120869 Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV Predict reactive species
Full Name	cytoskeleton associated protein 5
Observed Molecular Weight	220-240 kDa
GenBank Accession Number	BC120869
Gene Symbol	Ch-TOG
Gene ID (NCBI)	9793
RRID	AB_2882832
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q14008
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles.