Tested Applications
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-10960 targets Cofilin in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1399 Product name: Recombinant human Cofilin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species |
| Full Name | cofilin 1 (non-muscle) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 18-22 kDa |
| GenBank Accession Number | BC012318 |
| Gene Symbol | Cofilin |
| Gene ID (NCBI) | 1072 |
| RRID | AB_3672475 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23528 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation.Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Cofilin antibody CL488-10960 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Pierre (Verified Customer) (09-25-2025) | Good, would buy again.
|

