Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, human brain tissue, human skin tissue, mouse brain tissue, NIH/3T3 cells, rat brain tissue, NCI-H1299 cells |
| Positive IHC detected in | human colon tissue, human cervical cancer tissue, human heart tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10960-1-AP targets Cofilin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1399 Product name: Recombinant human Cofilin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species |
| Full Name | cofilin 1 (non-muscle) |
| Calculated Molecular Weight | 18 kDa |
| Observed Molecular Weight | 18-22 kDa |
| GenBank Accession Number | BC012318 |
| Gene Symbol | Cofilin |
| Gene ID (NCBI) | 1072 |
| RRID | AB_2291830 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23528 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation.Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cofilin antibody 10960-1-AP | Download protocol |
| IHC protocol for Cofilin antibody 10960-1-AP | Download protocol |
| WB protocol for Cofilin antibody 10960-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cofilin Polyclonal antibody (Cat# 10960-1-AP) has 44 citations. These appear in journals including Nature Communications, Cell Research, Cell Death & Discovery, Clinical and Translational Medicine, Frontiers in Immunology, International Journal of Molecular Sciences, Oncotarget, Cell Signaling, and Molecular Carcinogenesis, among others. Research fields span actin cytoskeleton dynamics, ciliogenesis, cancer (lung, colorectal, esophageal, cervical, prostate, and others), viral infection, neurogenesis, androgen/erectile function, and RNA/protein biology. Applications are predominantly Western blot, with immunofluorescence, IHC, and co-IP also used.
| Species | Application | Title |
|---|---|---|
Cell Res NudC regulates actin dynamics and ciliogenesis by stabilizing cofilin 1.
| ||
Nat Commun N-terminal α-amino SUMOylation promotes phosphorylation-independent cofilin-1 translocation to the mitochondrial matrix and induces apoptosis.
| ||
Nat Commun TM9SF4 is an F-actin disassembly factor that promotes tumor progression and metastasis
| ||
Nat Commun N-terminal α-amino SUMOylation of cofilin-1 is critical for its regulation of actin depolymerization | ||
Cell Death Discov Protein arginine methyltransferase 1 stimulates basal cell proliferation and migration to maintain corneal epithelial homeostasis. | ||
Neural Regen Res No DCX-positive neurogenesis in the cerebral cortex of the adult primate. |
Reviews
What customers say
The product received one review with a 5-star rating. The reviewer used the antibody for Western Blot at a 1:1000 dilution and described it simply as a "good antibody," indicating satisfaction with its performance in that application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura Balusa (Verified Customer) (01-08-2026) | GOOD ANTIBODY
|
