CoraLite® Plus 488-conjugated Collagen Type III (N-terminal) Recombinant monoclonal antibody

Collagen Type III (N-terminal) Uni-rAb® Recombinant Antibody for IF-P

Cat No. CL488-80009
Clone No.2O1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

COL3, COL3A1, 2O1, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80009 targets Collagen Type III (N-terminal) in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18658

Product name: Recombinant human COL3A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-152 aa of BC028178

Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS

Predict reactive species
Full Name collagen, type III, alpha 1
Calculated Molecular Weight 1466 aa, 139 kDa
Observed Molecular Weight 140-180 kDa
GenBank Accession NumberBC028178
Gene Symbol COL3A1
Gene ID (NCBI) 1281
RRIDAB_2919567
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02461
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody was raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen. It can't recognize mouse or rat type III collagen.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Collagen Type III (N-terminal) antibody CL488-80009Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...