Collagen Type III (N-terminal) Recombinant monoclonal antibody

Collagen Type III (N-terminal) Uni-rAb® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 80009-1-RR
Clone No.2O1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, ELISA

COL3, COL3A1, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain, Collagen Type III

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman colon tissue, human colon cancer tissue, human ovary tumor tissue, human pancreas cancer tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80009-1-RR targets Collagen Type III (N-terminal) in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18658

Product name: Recombinant human COL3A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-152 aa of BC028178

Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS

Predict reactive species
Full Name collagen, type III, alpha 1
Calculated Molecular Weight 1466 aa, 139 kDa
GenBank Accession NumberBC028178
Gene Symbol COL3A1
Gene ID (NCBI) 1281
RRIDAB_2882939
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02461
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody was raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen. It can't recognize mouse or rat type III collagen.

Protocols

Product Specific Protocols
IF protocol for Collagen Type III (N-terminal) antibody 80009-1-RRDownload protocol
IHC protocol for Collagen Type III (N-terminal) antibody 80009-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lucia (Verified Customer) (03-11-2025)

Antigen retrieval performed with citrate buffer in pressure cooker. Primary antibody 1h RT, tested 1:200 and 1:2000 and both gave similar results. Detection method Vector VECTASTAIN[R] Elite ABC-HRP Kit. Staining worked with immunofluorescence as well (1:200 1h RT).

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Human kidney cortex
Loading...
||
New chat

Able

正在加载,请稍候...