CoraLite®555-conjugated Collagen Type III (N-terminal) Recombinant monoclonal antibody

• 

  IF Staining of human colon using CL555-80009

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using CoraLite®555 Collagen Type III (N-terminal) antibody (CL555-80009, Clone: 2O1 ) at dilution of 1:200.

• 

  IF Staining of human colon using CL555-80009

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using CoraLite®555 Collagen Type III (N-terminal) antibody (CL555-80009, Clone: 2O1 ) at dilution of 1:200.

Collagen Type III (N-terminal) Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL555-80009

Clone No.2O1

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IF-P

Synonyms

COL3A1, Collagen alpha 1(III) chain, collagen, type III, alpha 1, EDS4A, FLJ34534

---

Tested Applications

• Positive IF-P detected in: human colon tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-80009 targets Collagen Type III (N-terminal) in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18658

  Product name: Recombinant human COL3A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-152 aa of BC028178

  Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS

• Full Name: collagen, type III, alpha 1
• Calculated Molecular Weight: 1466 aa, 139 kDa
• Observed Molecular Weight: 140-180 kDa
• GenBank Accession Number: BC028178
• Gene Symbol: COL3A1
• Gene ID (NCBI): 1281
• RRID: AB_2919707
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02461
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody was raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen. It can't recognize mouse or rat type III collagen.