Cytochrome c Recombinant monoclonal antibody

• 

  WB analysis using 83276-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83276-1-RR (Cytochrome c antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 83276-1-RR

  WB result of Cytochrome c antibody (83276-1-RR; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytochrome c transfected HepG2 cells.

• 

  IF Staining of A431 using 83276-1-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Cytochrome c antibody (83276-1-RR, Clone: 230503E10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 83276-1-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Cytochrome c Recombinant antibody (83276-1-RR, Clone:230503E10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Cytochrome c Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83276-1-RR

Clone No.230503E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

230503E10, CYC, CYCS

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, mouse kidney tissue
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83276-1-RR targets Cytochrome c in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1455

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_3670946
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P99999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.