• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Cytochrome c Recombinant monoclonal antibody

Cytochrome c Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL594-83276
Clone No.230503E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

CYCS, CYC, 230503E10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells, MCF-7

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-83276 targets Cytochrome c in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1455

Product name: Recombinant human Cytochrome c protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-105 aa of BC009578

Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Predict reactive species
Full Name cytochrome c, somatic
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 12-15 kDa
GenBank Accession NumberBC009578
Gene Symbol Cytochrome c
Gene ID (NCBI) 54205
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP99999
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.

Protocols

Product Specific Protocols
IF protocol for CL594 Cytochrome c antibody CL594-83276Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...