CoraLite®594-conjugated Cytochrome c Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL594-83276

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite®594 Cytochrome c antibody (CL594-83276, Clone: 230503E10 ) at dilution of 1:200.

• 

  IF Staining of MCF-7 using CL594-83276

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CoraLite®594 Cytochrome c antibody (CL594-83276, Clone: 230503E10 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Cytochrome c Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL594-83276

Clone No.230503E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

CYCS, CYC, 230503E10

---

Tested Applications

• Positive IF/ICC detected in: A431 cells, MCF-7

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-83276 targets Cytochrome c in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1455

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P99999
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.