• Featured Product
  • KD/KO Validated

CoraLite® Plus 750-conjugated Cytochrome c Recombinant monoclonal antibody

Cytochrome c Uni-rAb® Recombinant Antibody for WB, FC (Intra)
Cat No. CL750-83276
Clone No.230503E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra)

CYCS, CYC, 230503E10

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83276 targets Cytochrome c in WB, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1455

Product name: Recombinant human Cytochrome c protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-105 aa of BC009578

Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Predict reactive species
Full Name cytochrome c, somatic
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 12-15 kDa
GenBank Accession NumberBC009578
Gene Symbol Cytochrome c
Gene ID (NCBI) 54205
RRIDAB_3673778
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP99999
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 Cytochrome c antibody CL750-83276Download protocol
FC protocol for CL Plus 750 Cytochrome c antibody CL750-83276Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...