CoraLite® Plus 750-conjugated Cytochrome c Recombinant monoclonal antibody

• 

  WB analysis using CL750-83276

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-83276 (Cytochrome c antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HepG2 using CL750-83276

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug Coralite® Plus 750 Cytochrome C Recombinant Antibody (CL750-83276, Clone:230503E10)(red), or 0.8 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Cytochrome c Uni-rAb^® Recombinant Antibody for WB, FC (Intra)

Cat No. CL750-83276

Clone No.230503E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra)

Synonyms

CYCS, CYC, 230503E10

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83276 targets Cytochrome c in WB, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1455

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_3673778
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P99999
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.