Tested Applications
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-83276 targets Cytochrome c in IF/ICC applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag1455 Product name: Recombinant human Cytochrome c protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species |
Full Name | cytochrome c, somatic |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12-15 kDa |
GenBank Accession Number | BC009578 |
Gene Symbol | Cytochrome c |
Gene ID (NCBI) | 54205 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P99999 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. As a part of respiratory chain, cytochrome c plays a critical role in the process of oxidative phosphorylation and ATP producing. Besides, cytochrome c also gets implicated in apoptosis process. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, which is required for caspase-3 activation and the occurrence of apoptosis.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 Cytochrome c antibody CL488-83276 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |