Tested Applications
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Positive FC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
Flow Cytometry (FC) | FC : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL647-22208 targets Cytokeratin 7 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17528 Product name: Recombinant human KRT7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ Predict reactive species |
Full Name | keratin 7 |
Calculated Molecular Weight | 469 aa, 51 kDa |
Observed Molecular Weight | 51 kDa |
GenBank Accession Number | BC002700 |
Gene Symbol | Cytokeratin 7 |
Gene ID (NCBI) | 3855 |
RRID | AB_2934953 |
Conjugate | CoraLite® Plus 647 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P08729 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7 is a type II keratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 647 Cytokeratin 7 antibody CL647-22208 | Download protocol |
FC protocol for CL Plus 647 Cytokeratin 7 antibody CL647-22208 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |