Cytokeratin 7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cytokeratin 7 Polyclonal antibody (22208-1-AP)

Cytokeratin 7 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 22208-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA
For FC, select conjugated version.

Synonyms

KRT7, CK 7, CK7, CK-7, Cytokeratin,Keratin

• 

  WB analysis of A431 using 22208-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22208-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 22208-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 22208-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 22208-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22208-1-AP (Cytokeratin 7 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22208-1-AP (Cytokeratin 7 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 22208-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 22208-1-AP (Cytokeratin 7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse liver using 22208-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Cytokeratin 7 antibody (22208-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 22208-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using Cytokeratin 7 antibody (22208-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 22208-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Cytokeratin 7 antibody (22208-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cytokeratin 7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human lung cancer tissue, human bowen disease tissue, human breast cancer tissue, human kidney tissue, human ovary cancer tissue, human ovary tumor tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse liver tissue
• Positive IF/ICC detected in: A549 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22208-1-AP targets Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17528

  Product name: Recombinant human KRT7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-94 aa of BC002700

  Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ

• Full Name: keratin 7
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC002700
• Gene Symbol: Cytokeratin 7
• Gene ID (NCBI): 3855
• RRID: AB_2879030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08729
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Cytokeratin 7 Polyclonal Antibody (Cat# 22208-1-AP) has 2 total citations. These appear in Frontiers in Genetics and Ginekologia Polska. The cited research covers pre-eclampsia and macrophage-associated molecular networks using bioinformatics analysis, as well as expression profiling of human somatic mesenchymal stem cells derived from endometrium and umbilical cord. The associated research fields include obstetrics/gynecology, stem cell biology, and reproductive medicine.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Front Genet; Mechanistic study of pre-eclampsia and macrophage-associated molecular networks: bioinformatics insights from multiple datasets; Authors - Jinfeng Cao
human	IHC	Ginekol Pol; Expression profiles of human somatic mesenchymal stem cells derived from fresh endometrium, ectopic-endometrium and umbilical cord; Authors - Chunmei Li