DCHS1 Polyclonal antibody

• 

  WB analysis using 28144-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 28144-1-AP (DCHS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

DCHS1 Polyclonal Antibody for WB, ELISA

Cat No. 28144-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

Cadherin 19, Cadherin 25, CDH19, CDH25, dachsous 1 (Drosophila), DCHS1, FIB1, Fibroblast cadherin 1, FLJ11790, KIAA1773, PCDH16, Protein dachsous homolog 1, Protocadherin 16

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28144-1-AP targets DCHS1 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27226

  Product name: Recombinant human DCHS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1517-1718 aa of NM_003737

  Sequence: MPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVVASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGANGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEIN

• Full Name: dachsous 1 (Drosophila)
• Calculated Molecular Weight: 346 kDa
• Observed Molecular Weight: ~350 kDa
• GenBank Accession Number: NM_003737
• Gene Symbol: DCHS1
• Gene ID (NCBI): 8642
• RRID: AB_3669648
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCHS1 is one of two known pathogenic genes associated with mitral valve prolapse (MVP) , a common cardiac valve disease (PMID: 33225636). Dchs1 and Fat4 function as a ligand-receptor pair during murine development and these genes are required in multiple organs (PMID: 21303848).