CoraLite® Plus 488-conjugated DCLK1 Polyclonal antibody

DCLK1 Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-29800

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

IF-P, FC (Intra)

DCAMKL1, DCDC3A, DCLK, DCLK1, doublecortin like kinase 1, KIAA0369

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inNeuro-2a cells
Positive FC detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-29800 targets DCLK1 in IF-P, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32007

Product name: Recombinant human DCLK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 648-740 aa of NM_004734

Sequence: NDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF

Predict reactive species
Full Name doublecortin-like kinase 1
Calculated Molecular Weight82KD
Observed Molecular Weight48 kDa, 82 kDa
GenBank Accession NumberNM_004734
Gene Symbol DCLK1
Gene ID (NCBI) 9201
RRIDAB_3672840
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15075
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DCLK1 antibody CL488-29800Download protocol
IF protocol for CL Plus 488 DCLK1 antibody CL488-29800Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...