Tested Applications
| Positive IF-P detected in | mouse brain tissue |
| Positive FC (Intra) detected in | Neuro-2a cells |
| Positive FC detected in | Neuro-2a cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| Flow Cytometry (FC) | FC : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-29800 targets DCLK1 in IF-P, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32007 Product name: Recombinant human DCLK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 648-740 aa of NM_004734 Sequence: NDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF Predict reactive species |
| Full Name | doublecortin-like kinase 1 |
| Calculated Molecular Weight | 82KD |
| Observed Molecular Weight | 48 kDa, 82 kDa |
| GenBank Accession Number | NM_004734 |
| Gene Symbol | DCLK1 |
| Gene ID (NCBI) | 9201 |
| RRID | AB_3672840 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15075 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 DCLK1 antibody CL488-29800 | Download protocol |
| IF protocol for CL Plus 488 DCLK1 antibody CL488-29800 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





