CoraLite®594-conjugated DDX54 Monoclonal antibody

DDX54 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66664
Clone No.1H9F4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

EC:3.6.4.13, DP97, DDX 54, ATP-dependent RNA helicase DP97, ATP-dependent RNA helicase DDX54

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66664 targets DDX54 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25289

Product name: Recombinant human DDX54 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 778-881 aa of BC156669

Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Calculated Molecular Weight 98 kDa
Observed Molecular Weight 98 kDa
GenBank Accession NumberBC156669
Gene Symbol DDX54
Gene ID (NCBI) 79039
RRIDAB_2934739
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TDD1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.

Protocols

Product Specific Protocols
IF protocol for CL594 DDX54 antibody CL594-66664Download protocol
FC protocol for CL594 DDX54 antibody CL594-66664Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...