Tested Applications
Positive IF/ICC detected in | PC-3 cells |
Positive FC (Intra) detected in | PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-66664 targets DDX54 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species |
Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 |
Calculated Molecular Weight | 98 kDa |
Observed Molecular Weight | 98 kDa |
GenBank Accession Number | BC156669 |
Gene Symbol | DDX54 |
Gene ID (NCBI) | 79039 |
RRID | AB_2934739 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q8TDD1 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 DDX54 antibody CL594-66664 | Download protocol |
FC protocol for CL594 DDX54 antibody CL594-66664 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |