DR4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DR4 Polyclonal antibody, PBS Only (24063-1-PBS)

• 

  WB analysis using 24063-1-AP (same clone as 24063-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24063-1-AP (DR4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 24063-1-AP (same clone as 24063-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24063-1-AP (DR4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 24063-1-AP (same clone as 24063-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24063-1-AP (DR4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 24063-1-AP (same clone as 24063-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 24063-1-AP (DR4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24063-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 24063-1-AP (same clone as 24063-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug DR4 Polyclonal antibody (24063-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00017). This data was developed using the same antibody clone with 24063-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DR4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24063-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

APO2, CD261, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, TNFRSF10A

---

Product Information

24063-1-PBS targets DR4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20927

  Product name: Recombinant human DR4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 261-468 aa of BC012866

  Sequence: CCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDLLVDSGKFIYLEDGTGSAVSLE

• Full Name: tumor necrosis factor receptor superfamily, member 10a
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 37-55 kDa
• GenBank Accession Number: BC012866
• Gene Symbol: DR4
• Gene ID (NCBI): 8797
• RRID: AB_2879421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00220
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) is a member of the TNF superfamily. TRAIL activates apoptosis through the death receptors DR4 (also known as TRAILR1 and TNFRSF10A) and DR5 (also known as TRAILR2, KILLER and TNFRSF10B). DR4 and DR5 are single-pass type I membrane proteins that contain intracellular death domains (DD) and upon activation mediate apoptotic signals (PMID: 11163110). Binding of TRAIL to DR4 or DR5 results in receptor oligomerization and recruitment of FAS-associated protein with death domain (FADD) and caspase 8 to form a functional death-inducing signalling complex (DISC). Upon DISC formation, caspase 8 is cleaved and activated, which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PMID: 18813321). DR4 or DR5 promotes the activation of NF-kappa-B and play an important role in inflammation (PMID: 9430227, 19434100).