EDARADD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EDARADD Polyclonal antibody (32485-1-AP)

• 

  WB analysis using 32485-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32485-1-AP (EDARADD antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

EDARADD Polyclonal Antibody for WB, ELISA

Cat No. 32485-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Ectodysplasin-A receptor-associated adapter protein, EDAR-associated death domain protein, Protein crinkled homolog

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32485-1-AP targets EDARADD in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38064

  Product name: Recombinant human EDARADD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC128082

  Sequence: MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF

• Full Name: EDAR-associated death domain
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC128082
• Gene Symbol: EDARADD
• Gene ID (NCBI): 128178
• RRID: AB_3742630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WWZ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EDARADD (EDAR-associated death domain) is an adaptor protein that mediates the interaction between the extracellular Ectodysplasin A receptor (EDAR) and intracellular signaling components, orchestrating a series of downstream events that regulate key biological processes such as cell proliferation, differentiation, and apoptosis. EDARADD is a 25 KDa death domain-containing adaptor protein. EDARADD was shown to interact with TRAF1, -2 and -3 as well as with TAB2 (TAK1-binding protein 2) and is therefore likely to be responsible for coupling receptor activation with engagement of the NF-κB pathway (PMID: 23845861).