Tested Applications
Positive WB detected in | HSC-T6 cells, LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, U2OS cells, NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
68722-2-Ig targets EMC7/C15orf24 in WB, ELISA applications and shows reactivity with Human, Mouse , Rat samples.
Tested Reactivity | Human, Mouse , Rat |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26813 Product name: Recombinant human C15orf24 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-159 aa of BC104934 Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD Predict reactive species |
Full Name | chromosome 15 open reading frame 24 |
Observed Molecular Weight | 20-26 kDa |
GenBank Accession Number | BC104934 |
Gene Symbol | EMC7 |
Gene ID (NCBI) | 56851 |
RRID | AB_3670415 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9NPA0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EMC7/C15orf24 antibody 68722-2-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |