Tested Applications
| Positive WB detected in | HSC-T6 cells, LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, U2OS cells, NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68722-2-Ig targets EMC7/C15orf24 in WB, ELISA applications and shows reactivity with Human, Mouse , Rat samples.
| Tested Reactivity | Human, Mouse , Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26813 Product name: Recombinant human C15orf24 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-159 aa of BC104934 Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD Predict reactive species |
| Full Name | chromosome 15 open reading frame 24 |
| Observed Molecular Weight | 20-26 kDa |
| GenBank Accession Number | BC104934 |
| Gene Symbol | EMC7 |
| Gene ID (NCBI) | 56851 |
| RRID | AB_3670415 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NPA0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EMC7/C15orf24 antibody 68722-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







