EMC7/C15orf24 Monoclonal antibody, PBS Only

• 

  WB analysis using 68722-2-Ig (same clone as 68722-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68722-2-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 68722-2-Ig (same clone as 68722-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68722-2-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 68722-2-Ig (same clone as 68722-2-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68722-2-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-2-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 68722-2-Ig (same clone as 68722-2-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 68722-2-Ig (C15orf24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68722-2-PBS in a different storage buffer formulation.

EMC7/C15orf24 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68722-2-PBS

Clone No.1A10E1

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse , Rat

Applications

WB, Indirect ELISA

Synonyms

C11orf3, C15orf24, HT022, ORF1 FL1, UNQ905/PRO1926, UPF0480 protein C15orf24

---

Product Information

68722-2-PBS targets EMC7/C15orf24 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse , Rat samples.

• Tested Reactivity: Human, Mouse , Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26813

  Product name: Recombinant human C15orf24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-159 aa of BC104934

  Sequence: SEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD

• Full Name: chromosome 15 open reading frame 24
• Observed Molecular Weight: 20-26 kDa
• GenBank Accession Number: BC104934
• Gene Symbol: EMC7
• Gene ID (NCBI): 56851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPA0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mammalian ER membrane complex (EMC) is composed of 10 subunits, EMC 1-10. Endoplasmic reticulum membrane protein complex subunit 7(EMC7, also named C15orf24) is part of the endoplasmic reticulum membrane protein complex (EMC) that enables theenergy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins.