EML1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EML1 Polyclonal antibody, PBS Only (12765-1-PBS)

• 

  WB analysis using 12765-1-AP (same clone as 12765-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12765-1-AP (EML1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12765-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12765-1-AP (same clone as 12765-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12765-1-AP (EML1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12765-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 12765-1-AP (same clone as 12765-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 12765-1-AP (EML1 antibody) at dilution of 1:50 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12765-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 12765-1-AP (same clone as 12765-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12765-1-AP (EML1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12765-1-PBS in a different storage buffer formulation.

EML1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12765-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HuEMAP-1, EMAP-1, EMAP, Echinoderm microtubule-associated protein-like 1

---

Product Information

12765-1-PBS targets EML1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3429

  Product name: Recombinant human EML1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC033043

  Sequence: MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKSNIKRTSSSERVSPGGRRESNGDSRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSND

• Full Name: echinoderm microtubule associated protein like 1
• Calculated Molecular Weight: 815 aa, 90 kDa
• Observed Molecular Weight: 90-92 kDa
• GenBank Accession Number: BC033043
• Gene Symbol: EML1
• Gene ID (NCBI): 2009
• RRID: AB_10644132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00423
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EML1 is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type. The disease process in USHs involves the entire brain and is not limited to the posterior fossa or auditory and visual systems. The USHs are catagorized as type I (USH1A, USH1B, USH1C, USH1D, USH1E and USH1F), type II (USH2A and USH2B) and type III (USH3). The type I is the most severe form. Gene loci responsible for these three types are all mapped.